TRIM3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRIM3 Polyclonal antibody, PBS Only (28392-1-PBS)

• 

  WB analysis using 28392-1-AP (same clone as 28392-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28392-1-AP (TRIM3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28392-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 28392-1-AP (same clone as 28392-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 28392-1-AP (TRIM3 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28392-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 28392-1-AP (same clone as 28392-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 28392-1-AP (TRIM3 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28392-1-PBS in a different storage buffer formulation.

TRIM3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28392-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

RNF22, RING finger protein 97, RING finger protein 22, HAC1, FLJ16135

---

Product Information

28392-1-PBS targets TRIM3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28823

  Product name: Recombinant human TRIM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 187-324 aa of NM_001248006

  Sequence: SQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHE

• Full Name: tripartite motif-containing 3
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 75 kDa, 80-85 kDa
• GenBank Accession Number: NM_001248006
• Gene Symbol: TRIM3
• Gene ID (NCBI): 10612
• RRID: AB_2881131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75382
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRIM3, a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM family of genes is largely studied because of their roles in development, differentiation and host cell antiviral defenses. TRIM3 is a mammalian tumor suppressor whose loss can increase the incidence and promote the development of GBM(PMID: 23318451). TRIM3 has four isoforms with the MW of 67-80 kDa and can be detected as 75, 80, 82,85 kDa after posttranslational modification(PMID: 24947043/PMID: 24086586 ).