TRIM31 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRIM31 Polyclonal antibody, PBS Only (12543-1-PBS)

• 

  WB analysis of COLO 320 using 12543-1-AP (same clone as 12543-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 12543-1-AP (TRIM31 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12543-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HT-29 using 12543-1-AP (same clone as 12543-1-PBS)

  IP result of anti-TRIM31 (IP:12543-1-AP, 4ug; Detection:12543-1-AP 1:2000) with HT-29 cells lysate 1040 ug. This data was developed using the same antibody clone with 12543-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 12543-1-AP (same clone as 12543-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 12543-1-AP (TRIM31 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12543-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 12543-1-AP (same clone as 12543-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 12543-1-AP (TRIM31 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12543-1-PBS in a different storage buffer formulation.

• 

  IHC staining of Human Colon cancer using 12543-1-AP (same clone as 12543-1-PBS)

  Immunohistochemical analysis of paraffin-embedded Human Colon cancer tissue slide using 12543-1-AP (TRIM31 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12543-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TRIM31 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12543-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12543-1-PBS targets TRIM31 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3264

  Product name: Recombinant human TRIM31 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 126-425 aa of BC017017

  Sequence: HNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFCKVPSS

• Full Name: tripartite motif-containing 31
• Calculated Molecular Weight: 425 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC017017
• Gene Symbol: TRIM31
• Gene ID (NCBI): 11074
• RRID: AB_10640897
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZY9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRIM31(Tripartite motif-containing protein 31) is also named as C6orf13, RNF and belongs to the TRIM/RBCC family. The deduced protein contains an N-terminal RING domain, a B-box-2 domain, and a coiled-coil region. TRIM31 forms homodimers(PMID:11331580). This protein has 2 isoforms produced by alternative splicing.