TRIM35 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRIM35 Polyclonal antibody, PBS Only (19806-1-PBS)

• 

  WB analysis of A431 using 19806-1-AP (same clone as 19806-1-PBS)

  WB result of TRIM35 antibody (19806-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRIM35 transfected A431 cells. This data was developed using the same antibody clone with 19806-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 19806-1-AP (same clone as 19806-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19806-1-AP (TRIM35 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19806-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 19806-1-AP (same clone as 19806-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 19806-1-AP (TRIM35 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19806-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 19806-1-AP (same clone as 19806-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 19806-1-AP (TRIM35 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19806-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 19806-1-AP (same clone as 19806-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 19806-1-AP (TRIM35 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19806-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 19806-1-AP (same clone as 19806-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using TRIM35 antibody (19806-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 19806-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TRIM35 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 19806-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

E3 ubiquitin-protein ligase TRIM35, EC:2.3.2.27, HLS5, KIAA1098, tripartite motif containing 35

---

Product Information

19806-1-PBS targets TRIM35 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13584

  Product name: Recombinant human TRIM35 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-206 aa of BC018337

  Sequence: MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPADLRTNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLCCSCQADPRHQGHRVQPVKDTAHDFRVRSLIAEERRNFLPTHQWIVTKTRLQTSSPNLQSRRQGQVQEHGACTAGEGQGLLGHAALL

• Full Name: tripartite motif-containing 35
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 45~50 kDa
• GenBank Accession Number: BC018337
• Gene Symbol: TRIM35
• Gene ID (NCBI): 23087
• RRID: AB_3741968
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPQ4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Tripartite motif 35 (TRIM35), also called hemopoietic lineage switch (Hls5), is a member of the RING finger, B box, coiled-coil (RBCC), or TRIM family E3 ligases expressed in a wide variety of hemopoietic cell types, including fetal liver progenitors. TRIM35 is reported to be a tumor suppressor gene and is expressed at low levels in several types of cancer (PMID: 34124276, 35081724). Western detected a band at 45-50 kDa possibly due to the high proline content.