TRIM40 Monoclonal antibody

• 

  WB analysis using 67073-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67073-1-Ig (TRIM40 antibody) at dilution of 1:1400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig small intestine using 67073-1-Ig

  pig small intestine tissue were subjected to SDS PAGE followed by western blot with 67073-1-Ig (TRIM40 antibody) at dilution of 1:1400 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67073-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67073-1-Ig (TRIM40 antibody) at dilution of 1:1400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human small intestine using 67073-1-Ig

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 67073-1-Ig (TRIM40 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human small intestine using 67073-1-Ig

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 67073-1-Ig (TRIM40 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 67073-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TRIM40 antibody (67073-1-Ig, Clone: 1C5D3 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red).

TRIM40 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67073-1-Ig

Clone No.1C5D3

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1C5D3, E3 ubiquitin ligase TRIM40, EC:2.3.2.27, Probable E3 NEDD8-protein ligase, RNF35

---

Tested Applications

• Positive WB detected in: NCCIT cell, THP-1 cells, pig small intestine tissue, HT-29 cells, NCCIT cells, JAR cells
• Positive IHC detected in: human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:600-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

67073-1-Ig targets TRIM40 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21660

  Product name: Recombinant human TRIM40 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-258 aa of BC060785

  Sequence: MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL

• Full Name: tripartite motif-containing 40
• Calculated Molecular Weight: 258 aa, 29 kDa
• Observed Molecular Weight: 26-36 kDa
• GenBank Accession Number: BC060785
• Gene Symbol: TRIM40
• Gene ID (NCBI): 135644
• RRID: AB_2882382
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6P9F5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; EGFR core fucosylation, induced by hepatitis C virus, promotes TRIM40-mediated-RIG-I ubiquitination and suppresses interferon-I antiviral defenses; Authors - Qiu Pan
human	WB	Cell Rep; Type I interferon/STAT1 signaling regulates UBE2M-mediated antiviral innate immunity in a negative feedback manner; Authors - Xianghui Kong