TRIM40 Monoclonal antibody, PBS Only

• 

  WB analysis using 67073-1-Ig (same clone as 67073-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67073-1-Ig (TRIM40 antibody) at dilution of 1:1400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67073-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig small intestine using 67073-1-Ig (same clone as 67073-1-PBS)

  pig small intestine tissue were subjected to SDS PAGE followed by western blot with 67073-1-Ig (TRIM40 antibody) at dilution of 1:1400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67073-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67073-1-Ig (same clone as 67073-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67073-1-Ig (TRIM40 antibody) at dilution of 1:1400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67073-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 67073-1-Ig (same clone as 67073-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 67073-1-Ig (TRIM40 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67073-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 67073-1-Ig (same clone as 67073-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 67073-1-Ig (TRIM40 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67073-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67073-1-Ig (same clone as 67073-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TRIM40 antibody (67073-1-Ig, Clone: 1C5D3 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67073-1-PBS in a different storage buffer formulation.

TRIM40 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67073-1-PBS

Clone No.1C5D3

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1C5D3, E3 ubiquitin ligase TRIM40, EC:2.3.2.27, Probable E3 NEDD8-protein ligase, RNF35

---

Product Information

67073-1-PBS targets TRIM40 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21660

  Product name: Recombinant human TRIM40 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-258 aa of BC060785

  Sequence: MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL

• Full Name: tripartite motif-containing 40
• Calculated Molecular Weight: 258 aa, 29 kDa
• Observed Molecular Weight: 26-36 kDa
• GenBank Accession Number: BC060785
• Gene Symbol: TRIM40
• Gene ID (NCBI): 135644
• RRID: AB_2882382
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6P9F5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.