CoraLite® Plus 488-conjugated TRIM54 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-83175-2

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 TRIM54 antibody (CL488-83175-2, Clone: 230391G5 ) at dilution of 1:200.

TRIM54 Recombinant Antibody for IF/ICC

Cat No. CL488-83175-2

Clone No.230391G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

RNF30, Muscle-specific RING finger protein 3, Muscle-specific RING finger protein, MuRF-3, MuRF3

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83175-2 targets TRIM54 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15229

  Product name: Recombinant human TRIM54 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 178-358 aa of BC141807

  Sequence: IAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP

• Full Name: tripartite motif-containing 54
• Calculated Molecular Weight: 358 aa, 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC141807
• Gene Symbol: TRIM54
• Gene ID (NCBI): 57159
• RRID: AB_3673215
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BYV2
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

TRIM54 (Tripartite motif-containing protein 54) is also names as MURF, MURF3, RNF30. The expression of TRIM54 is required for skeletal myoblast differentiation and myotube fusion. It is expressed in heart and skeletal muscle specifically (PMID:11243782). It has two isoforms with the molecular weight of 40KDa and 45KDa. It can be dimerizated and hetero-dimerizated to form homooligomer and heterooligomer (PMID:15967462).