TRIM6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRIM6 Polyclonal antibody, PBS Only (11953-1-PBS)

• 

  WB analysis using 11953-1-AP (same clone as 11953-1-PBS)

  HepG2 cell lysates were subjected to SDS PAGE followed by western blot with 11953-1-AP (TRIM6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11953-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 11953-1-AP (same clone as 11953-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 11953-1-AP (TRIM6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11953-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 11953-1-AP (same clone as 11953-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 11953-1-AP (TRIM6 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11953-1-AP (same clone as 11953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11953-1-AP (TRIM6 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11953-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TRIM6 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11953-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:2.3.2.27, RING finger protein 89, RING-type E3 ubiquitin transferase TRIM6, RNF89, TRIM

---

Product Information

11953-1-PBS targets TRIM6 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2556

  Product name: Recombinant human TRIM6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 96-395 aa of BC065575

  Sequence: QLRNILDRVEQRELKKLEQEEKKGLRIIEEAENDLVHQTQSLRELISDLERRCQGSTMELLQDVSDVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVCRELTDVQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFSSGKHYWEVDVAKKTAWILGVCSNSLGPTFSFNHFAQNHSAYSRYQPQSGYWVIGLQHNHEYRAYEDSSPSLLLSMTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPCNCVIPMTLRRPSS

• Full Name: tripartite motif-containing 6
• Calculated Molecular Weight: 488 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC065575
• Gene Symbol: TRIM6
• Gene ID (NCBI): 117854
• RRID: AB_874230
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C030
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.