TRIM69 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRIM69 Polyclonal antibody, PBS Only (29907-1-PBS)

• 

  WB analysis using 29907-1-AP (same clone as 29907-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29907-1-AP (TRIM69 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29907-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 29907-1-AP (same clone as 29907-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29907-1-AP (TRIM69 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29907-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 29907-1-AP (same clone as 29907-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29907-1-AP (TRIM69 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29907-1-PBS in a different storage buffer formulation.

TRIM69 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29907-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

29907-1-PBS targets TRIM69 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31775

  Product name: Recombinant human TRIM69 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-190 aa of BC033314

  Sequence: MEEELAIQQGQLETTLKELQTLRNMQKEAIAAHKENKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEGKALNEEMELNLSQLQEQCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSKSQTSVWHGD

• Full Name: tripartite motif-containing 69
• Calculated Molecular Weight: 500 aa, 57 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC033314
• Gene Symbol: TRIM69
• Gene ID (NCBI): 140691
• RRID: AB_2935487
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86WT6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

E3 ubiquitin-protein ligase TRIM69 (TRIM69) plays an important role in antiviral immunity by restricting different viral infections including dengue virus or vesicular stomatitis Indiana virus (PubMed:31375575, PubMed:31578292). It plays also a role in cataract formation together with TP53 (PubMed:30844644). Mechanistically, inhibits UVB-induced cell apoptosis and reactive oxygen species (ROS) production by inducing TP53 ubiquitination (PubMed:30844644). It has 4 isoforms with molecular weights of 57, 39, 34, and 32 kDa.