TRIP6 Polyclonal antibody

• 

  WB analysis of HeLa using 21163-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21163-1-AP (TRIP6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 21163-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21163-1-AP (TRIP6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 21163-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 21163-1-AP (TRIP6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 21163-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21163-1-AP (TRIP6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 21163-1-AP

  Immunofluorescent analysis of HepG2 cells, using TRIP6 antibody 21163-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

TRIP6 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21163-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

OIP 1, OIP1, Opa interacting protein 1, TR interacting protein 6, TRIP 6, TRIP6, ZRP 1, Zyxin related protein 1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, human testis tissue, mouse lung tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21163-1-AP targets TRIP6 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15149

  Product name: Recombinant human TRIP6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 127-476 aa of BC004249

  Sequence: PPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVAFDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC

• Full Name: thyroid hormone receptor interactor 6
• Calculated Molecular Weight: 476 aa, 50 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC004249
• Gene Symbol: TRIP6
• Gene ID (NCBI): 7205
• RRID: AB_10732813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15654
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIP6 (thyroid receptor-interacting protein 6), also known as ZRP-1 (zyxin-related protein 1), is a member of the zyxin family that has been implicated in actin reorganization and cell motility. Trip6 has been proposed to transport signals from the cell surface to the nucleus.