TRIP6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRIP6 Polyclonal antibody (21163-1-AP)

TRIP6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21163-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

OIP1, OIP-1, Opa-interacting protein 1, Thyroid receptor-interacting protein 6, TR-interacting protein 6

• 

  WB analysis using 21163-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21163-1-AP (TRIP6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 21163-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21163-1-AP (TRIP6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 21163-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21163-1-AP (TRIP6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 21163-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 21163-1-AP (TRIP6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 21163-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21163-1-AP (TRIP6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 21163-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 21163-1-AP (TRIP6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 21163-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 21163-1-AP (TRIP6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 21163-1-AP

  Immunofluorescent analysis of HepG2 cells, using TRIP6 antibody 21163-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRIP6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, human testis tissue, mouse lung tissue, L02 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21163-1-AP targets TRIP6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15149

  Product name: Recombinant human TRIP6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 127-476 aa of BC004249

  Sequence: PPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVAFDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC

• Full Name: thyroid hormone receptor interactor 6
• Calculated Molecular Weight: 476 aa, 50 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC004249
• Gene Symbol: TRIP6
• Gene ID (NCBI): 7205
• RRID: AB_10732813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15654
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIP6 (thyroid receptor-interacting protein 6), also known as ZRP-1 (zyxin-related protein 1), is a member of the zyxin family that has been implicated in actin reorganization and cell motility. Trip6 has been proposed to transport signals from the cell surface to the nucleus.

Publications

What published studies show

The TRIP6 Polyclonal antibody (Cat# 21163-1-AP) has 3 citations. They appear in European Journal of Cell Biology (cell junctions/actin mechanics), Experimental Cell Research (craniofacial skeletal development), and Phytomedicine (high-altitude acute lung injury). Research fields span cell biology, developmental biology, and pharmacology. Applications cited include IF (human) and WB (rat).

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Eur J Cell Biol; The TRIP6/LATS1 complex constitutes the tension sensor of α-catenin/vinculin at both bicellular and tricellular junctions.; Authors - Lin Xie
rat	WB	Phytomedicine; Integrating network pharmacology and proteomics to elucidate the mechanism of Allium macrostemon total saponins in alleviating high-altitude acute lung injury.; Authors - Keke Liang
		Exp Cell Res; OPTN-TRIP6-mediated F-actin mechanical support regulates phagophore closure to govern craniofacial skeletal development.; Authors - Zhenyi Lu