TRIP6 Monoclonal antibody

• 

  WB analysis of HeLa using 60205-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 60205-1-Ig (TRIP6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 60205-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver using 60205-1-Ig(TRIP6 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 60205-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver using 60205-1-Ig(TRIP6 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon cancer using 60205-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 60205-1-Ig(TRIP6 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon cancer using 60205-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 60205-1-Ig(TRIP6 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon using 60205-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon using 60205-1-Ig(TRIP6 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon using 60205-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon using 60205-1-Ig(TRIP6 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human gliomas using 60205-1-Ig

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 60205-1-Ig (TRIP6 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 60205-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 60205-1-Ig (TRIP6 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 60205-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 60205-1-Ig (TRIP6 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TRIP6 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60205-1-Ig

Clone No.5D8C7

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

5D8C7, OIP1, OIP-1, Opa-interacting protein 1, Thyroid receptor-interacting protein 6

---

Tested Applications

• Positive WB detected in: Hela cells
• Positive IHC detected in: human ovary tumor tissue, human liver tissue, human colon cancer tissue, human colon tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

60205-1-Ig targets TRIP6 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15149

  Product name: Recombinant human TRIP6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 127-476 aa of BC004249

  Sequence: PPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVAFDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC

• Full Name: thyroid hormone receptor interactor 6
• Calculated Molecular Weight: 476 aa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC004249
• Gene Symbol: TRIP6
• Gene ID (NCBI): 7205
• RRID: AB_10973674
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15654
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIP6 (thyroid receptor-interacting protein 6), also known as ZRP-1 (zyxin-related protein 1), is a member of the zyxin family that has been implicated in actin reorganization and cell motility. Trip6 has been proposed to transport signals from the cell surface to the nucleus.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Dev Cell; Nuclear Pores Regulate Muscle Development and Maintenance by Assembling a Localized Mef2C Complex.; Authors - Marcela Raices