CoraLite® Plus 488-conjugated TRIP6 Monoclonal antibody

TRIP6 Monoclonal Antibody for FC (Intra)

Cat No. CL488-60205
Clone No.5D8C7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

FC (Intra)

OIP 1, OIP1, Opa interacting protein 1, TR interacting protein 6, TRIP 6, TRIP6, ZRP 1, Zyxin related protein 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells, HeLa cells
Positive FC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60205 targets TRIP6 in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15149

Product name: Recombinant human TRIP6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 127-476 aa of BC004249

Sequence: PPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVAFDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC

Predict reactive species
Full Name thyroid hormone receptor interactor 6
Calculated Molecular Weight 476 aa, 50 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC004249
Gene Symbol TRIP6
Gene ID (NCBI) 7205
RRIDAB_3672861
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15654
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TRIP6 (thyroid receptor-interacting protein 6), also known as ZRP-1 (zyxin-related protein 1), is a member of the zyxin family that has been implicated in actin reorganization and cell motility. Trip6 has been proposed to transport signals from the cell surface to the nucleus.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 TRIP6 antibody CL488-60205Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...