TRMT10A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRMT10A Polyclonal antibody, PBS Only (17294-1-PBS)

• 

  WB analysis using 17294-1-AP (same clone as 17294-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17294-1-AP (TRMT10A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17294-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 17294-1-AP (same clone as 17294-1-PBS)

  IP result of anti-TRMT10A (IP:17294-1-AP, 4ug; Detection:17294-1-AP 1:3000) with HeLa cells lysate 1200 ug. This data was developed using the same antibody clone with 17294-1-PBS in a different storage buffer formulation.

TRMT10A Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 17294-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

RG9MTD2, EC:2.1.1.221, guanine-9-, RNA, TRM10

---

Product Information

17294-1-PBS targets TRMT10A in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11172

  Product name: Recombinant human RG9MTD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-339 aa of BC028373

  Sequence: MSSEMLPAFIETSNVDKKQGINEDQEESQKPRLGEGCEPISKRQMKKLIKQKQWEEQRELRKQKRKEKRKRKKLERQCQMEPNSDGHDRKRVRRDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQFYLTSHGGQLKKNMDENDKGWVNWKDIHIKPEHYSELIKKEDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHAQLPLGNFVKMNSRKVLAVNHVFEIILEYLETRDWQEAFFTILPQRKGAVPTDKACESASHDNQSVRMEEGGSDSDSSEEEYSRNELDSPHEEKQDKENHTESTVNSLPH

• Full Name: RNA (guanine-9-) methyltransferase domain containing 2
• Calculated Molecular Weight: 339 aa, 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC028373
• Gene Symbol: RG9MTD2
• Gene ID (NCBI): 93587
• RRID: AB_2878377
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TBZ6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRMT10A is a tRNA methyltransferase responsible for catalyzing the formation of N1-methylguanosine (m1G) at position 9 (m1G9) in tRNAs. Deficiencies in TRMT10A function have been linked to developmental disorders, including intellectual disability and microcephaly.