TRMT10C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRMT10C Polyclonal antibody, PBS Only (29087-1-PBS)

• 

  WB analysis using 29087-1-AP (same clone as 29087-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29087-1-AP (TRMT10C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29087-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 29087-1-AP (same clone as 29087-1-PBS)

  WB result of TRMT10C antibody (29087-1-AP; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRMT10C transfected HepG2 cells. This data was developed using the same antibody clone with 29087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 29087-1-AP (same clone as 29087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29087-1-AP (TRMT10C antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 29087-1-AP (same clone as 29087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29087-1-AP (TRMT10C antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29087-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 29087-1-AP (same clone as 29087-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using TRMT10C antibody (29087-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 29087-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TRMT10C Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 29087-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

RG9MTD1, MRPP1

---

Product Information

29087-1-PBS targets TRMT10C in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30642

  Product name: Recombinant human TRMT10C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 40-178 aa of NM_017819

  Sequence: MSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKEKVKKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFL

• Full Name: RNA (guanine-9-) methyltransferase domain containing 1
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: NM_017819
• Gene Symbol: TRMT10C
• Gene ID (NCBI): 54931
• RRID: AB_2881239
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L0Y3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

tRNA methyltransferase 10 homolog C (TRMT10C, also known as MRPP1) is involved in mitochondrial RNA processing and modification (PMID: 21593607). It is essential for the 5'-ends processing of mitochondrial tRNAs and plays a critical role in mitochondrial respiration and translation (PMID: 18984158; 29040705). Mutations in TRMT10C may be a cause of mitochondrial disease and highlight the importance of RNA processing for correct mitochondrial function (PMID: 27132592).