TRMT2A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83463-8-RR (same clone as 83463-8-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83463-8-RR (TRMT2A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83463-8-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 83463-8-RR (same clone as 83463-8-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 83463-8-RR (TRMT2A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83463-8-PBS in a different storage buffer formulation.

• 

  FC experiment of U-251 using 83463-8-RR (same clone as 83463-8-PBS)

  1x10^6 U-251 cells were intracellularly stained with 0.25 ug TRMT2A Recombinant antibody (83463-8-RR, Clone:240444C2) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83463-8-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83463-8-RR

  Biolayer interferometry (BLl) kinetic assays of 83463-8-RR against Human TRMT2A were performed. The affinity constant is 1.86 nM.

TRMT2A Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 83463-8-PBS

Clone No.240444C2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

240444C2, EC:2.1.1.-, EC:2.1.1.35, HTF9C, mRNA

---

Product Information

83463-8-PBS targets TRMT2A in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9112

  Product name: Recombinant human TRMT2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 277-625 aa of BC013352

  Sequence: DTVHIPEATKQVVKAFQEFIRSTPYSAYDPETYTGHWKQLTVRTSRRHQAMAIAYFHPQKLSPEELAELKTSLAQHFTAGPGRASGVTCLYFVEEGQRKTPSQEGLPLEHVAGDRCIHEDLLGLTFRISPHAFFQVNTPAAEVLYTVIQDWAQLDAGSMVLDVCCGTGTIGLALARKVKRVIGVELCPEAVEDARVNAQDNELSNVEFHCGRAEDLVPTLVSRLASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS

• Full Name: TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 625 aa, 69 kDa
• Observed Molecular Weight: 42-44 kDa, 68-75 kDa
• GenBank Accession Number: BC013352
• Gene Symbol: TRMT2A
• Gene ID (NCBI): 27037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8IZ69
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

tRNA methyltransferase 2 homolog A (TRMT2A), also known as HTF9C is a novel cell cycle regulated protein, as associated with aggressive clinical course. HTF9C harbors a putative RNA recognition motif (RRM) in the N-terminus and the conserved uracil-C5-methyltransferase domain of the TrmA family in the C-terminus. HTF9C antibody can detect two bands about 68 kDa and 40 kDa (PMID: 20307320).