TRMT2A Recombinant monoclonal antibody

TRMT2A Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83463-8-RR
Clone No.240444C2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

240444C2, EC:2.1.1.-, EC:2.1.1.35, HTF9C, mRNA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, A431 cells, MCF-7 cells, MOLT-4 cells, HepG2 cells
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inU-251 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83463-8-RR targets TRMT2A in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9112

Product name: Recombinant human TRMT2A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 277-625 aa of BC013352

Sequence: DTVHIPEATKQVVKAFQEFIRSTPYSAYDPETYTGHWKQLTVRTSRRHQAMAIAYFHPQKLSPEELAELKTSLAQHFTAGPGRASGVTCLYFVEEGQRKTPSQEGLPLEHVAGDRCIHEDLLGLTFRISPHAFFQVNTPAAEVLYTVIQDWAQLDAGSMVLDVCCGTGTIGLALARKVKRVIGVELCPEAVEDARVNAQDNELSNVEFHCGRAEDLVPTLVSRLASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS

Predict reactive species
Full Name TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae)
Calculated Molecular Weight 625 aa, 69 kDa
Observed Molecular Weight 42-44 kDa, 68-75 kDa
GenBank Accession NumberBC013352
Gene Symbol TRMT2A
Gene ID (NCBI) 27037
RRIDAB_3671094
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ8IZ69
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

tRNA methyltransferase 2 homolog A (TRMT2A), also known as HTF9C is a novel cell cycle regulated protein, as associated with aggressive clinical course. HTF9C harbors a putative RNA recognition motif (RRM) in the N-terminus and the conserved uracil-C5-methyltransferase domain of the TrmA family in the C-terminus. HTF9C antibody can detect two bands about 68 kDa and 40 kDa (PMID: 20307320).

Protocols

Product Specific Protocols
FC protocol for TRMT2A antibody 83463-8-RRDownload protocol
IHC protocol for TRMT2A antibody 83463-8-RRDownload protocol
WB protocol for TRMT2A antibody 83463-8-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...