TRMT2B Polyclonal antibody

• 

  WB analysis of HepG2 using 20767-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20767-1-AP (TRMT2B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 20767-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20767-1-AP (TRMT2B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 20767-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 20767-1-AP (TRMT2B antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 20767-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 20767-1-AP (TRMT2B antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon using 20767-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon using 20767-1-AP (TRMT2B antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon using 20767-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon using 20767-1-AP (TRMT2B antibody) at dilution of 1:50 (under 40x lens).

TRMT2B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20767-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CXorf34, TRM2 homolog, TRMT2B

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IHC detected in: human liver cancer tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20767-1-AP targets TRMT2B in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14750

  Product name: Recombinant human TRMT2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 89-247 aa of BC007526

  Sequence: TPLWRLSYEEQLKVKFAAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHP

• Full Name: TRM2 tRNA methyltransferase 2 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 504 aa, 56 kDa
• Observed Molecular Weight: 50-56 kDa
• GenBank Accession Number: BC007526
• Gene Symbol: TRMT2B
• Gene ID (NCBI): 79979
• RRID: AB_10693626
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96GJ1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.