TRMT61A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRMT61A Polyclonal antibody, PBS Only (31169-1-PBS)

• 

  WB analysis using 31169-1-AP (same clone as 31169-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31169-1-AP (TRMT61A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31169-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 31169-1-AP (same clone as 31169-1-PBS)

  WB result of TRMT61A antibody (31169-1-AP; 1:3000; room temperature for 1.5 hours) with wild-type and TRMT61A knockout RAW 264.7 cells. This data was developed using the same antibody clone with 31169-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TRMT61A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31169-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

C14orf172, EC:2.1.1.-, EC:2.1.1.220, GCD14, Gcd14p

---

Product Information

31169-1-PBS targets TRMT61A in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34396

  Product name: Recombinant human TRMT61A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-289 aa of BC010167

  Sequence: SFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG

• Full Name: tRNA methyltransferase 61 homolog A (S. cerevisiae)
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC010167
• Gene Symbol: TRMT61A
• Gene ID (NCBI): 115708
• RRID: AB_3669880
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96FX7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

N1-methyladenosine (m1A) is an important posttranscriptional modification and occurs throughout the tRNA structure.m1A at position 58 (m1A58) is the predominant m1A modification of cytoplasmic tRNA in eukaryotic cells. The formation of m1A58 on cytoplasmic tRNAs is mediated by the methyltransferase complex TRMT6/TRMT61A, in which TRMT61A functions as the catalytic subunit and TRMT6 is responsible for tRNA binding.