TRMU Recombinant monoclonal antibody, PBS Only

TRMU Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 86095-1-PBS
Clone No.250434A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

EC:2.8.1.14, Mitochondrial tRNA-specific 2-thiouridylase 1, MTO2, MTO2 homolog, MTU1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86095-1-PBS targets TRMU in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag21930

Product name: Recombinant human TRMU protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-267 aa of BC027991

Sequence: MKKSLSRSTLRSPKGFSEIGLKLEMVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL

Predict reactive species
Full Name tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
Calculated Molecular Weight 421 aa, 48 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC027991
Gene Symbol TRNT1
Gene ID (NCBI) 55687
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75648
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TRMU (tRNA m5C methyltransferase) is a mitochondrial protein involved in the modification of mitochondrial tRNA. Specifically, it catalyzes the formation of 5-methylcytidine at position 34 (m5C34) in the anticodon stem-loop of mitochondrial tRNAs, which is crucial for maintaining the stability and function of these tRNAs. TRMU is a nuclear-encoded protein located in the mitochondrial matrix. It plays a vital role in mitochondrial translation and oxidative phosphorylation.TRMU is associated with several genetic disorders. Mutations in the TRMU gene can cause mitochondrial diseases, such as infantile hepatic failure syndrome. (PMID:23625533)

Loading...
||
New chat Able
正在加载,请稍候...