TRMU Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRMU Polyclonal antibody, PBS Only (25376-1-PBS)

• 

  IHC staining of mouse skeletal muscle using 25376-1-AP (same clone as 25376-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25376-1-AP (TRMU antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25376-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 25376-1-AP (same clone as 25376-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25376-1-AP (TRMU antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25376-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 25376-1-AP (same clone as 25376-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 25376-1-AP (TRMU antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25376-1-PBS in a different storage buffer formulation.

TRMU Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 25376-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

EC:2.8.1.14, Mitochondrial tRNA-specific 2-thiouridylase 1, MTO2, MTO2 homolog, MTU1

---

Product Information

25376-1-PBS targets TRMU in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21930

  Product name: Recombinant human TRMU protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-267 aa of BC027991

  Sequence: MKKSLSRSTLRSPKGFSEIGLKLEMVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL

• Full Name: tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
• Calculated Molecular Weight: 421 aa, 48 kDa
• GenBank Accession Number: BC027991
• Gene Symbol: TRNT1
• Gene ID (NCBI): 55687
• RRID: AB_3085793
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75648
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.