TROVE2 Polyclonal antibody

• 

  WB analysis of MCF-7 using 12718-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 12718-1-AP (TROVE2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12718-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12718-1-AP (TROVE2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat spleen using 12718-1-AP

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 12718-1-AP (TROVE2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 12718-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 12718-1-AP (TROVE2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 12718-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12718-1-AP (TROVE2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of PC-3 using 12718-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using TROVE2 antibody (12718-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

TROVE2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 12718-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

SS A, RoRNP, Ro60 autoantigen, RO60, RNA-binding protein RO60

---

Tested Applications

• Positive WB detected in: MCF7 cells, HeLa cells, mouse thymus tissue, PC-3 cells, rat spleen tissue
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12718-1-AP targets TROVE2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3412

  Product name: Recombinant human TROVE2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-369 aa of BC036658

  Sequence: DGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGK

• Full Name: TROVE domain family, member 2
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC036658
• Gene Symbol: TROVE2
• Gene ID (NCBI): 6738
• RRID: AB_2209756
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10155
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TROVE2, also named as RO60 or RoRNP, is a 538 amino acid protein, which is localized in cytoplasmic mRNP granules containing untranslated mRNAs. TROVE2 as a RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. TROVE2 may stabilize some of these RNAs and protect them from degradation (PubMed:18056422). TROVE2 binds to endogenous Alu retroelements which are induced by type I IFN and stimulate porinflammaotry cytokine secretion.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Exp Clin Cancer Res; Selective sorting and secretion of hY4 RNA fragments into extracellular vesicles mediated by methylated YBX1 to promote lung cancer progression.; Authors - Chuang Li