TRPC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRPC1 Polyclonal antibody, PBS Only (24727-1-PBS)

• 

  WB analysis using 24727-1-AP (same clone as 24727-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24727-1-AP (TRPC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24727-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24727-1-AP (same clone as 24727-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24727-1-AP (TRPC1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24727-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 24727-1-AP (same clone as 24727-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24727-1-AP (TRPC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24727-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 24727-1-AP (same clone as 24727-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24727-1-AP (TRPC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24727-1-PBS in a different storage buffer formulation.

TRPC1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24727-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

24727-1-PBS targets TRPC1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16488

  Product name: Recombinant human TRPC1 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-349 aa of BC113953

  Sequence: MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTP

• Full Name: transient receptor potential cation channel, subfamily C, member 1
• Calculated Molecular Weight: 793 aa, 91 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC113953
• Gene Symbol: TRPC1
• Gene ID (NCBI): 7220
• RRID: AB_3085750
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48995
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRPC1, also named as TRP1, belongs to the transient receptor family and STrpC subfamily. TRPC1 is thought to form a receptor-activated non-selective calcium permeant cation channel. It has been reported that the mGluR1 evoked slow EPSC is mediated by the TRPC1 cation channel. It is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors.