TRPV1 Monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 66983-1-Ig (same clone as 66983-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66983-1-Ig (TRPV1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66983-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDA-MB-468 using 66983-1-Ig (same clone as 66983-1-PBS)

  MDA-MB-468 cells were subjected to SDS PAGE followed by western blot with 66983-1-Ig (TRPV1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66983-1-PBS in a different storage buffer formulation.

• 

  WB analysis of T-47D using 66983-1-Ig (same clone as 66983-1-PBS)

  T-47D cells were subjected to SDS PAGE followed by western blot with 66983-1-Ig (TRPV1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66983-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66983-1-Ig (same clone as 66983-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66983-1-Ig (TRPV1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66983-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Y79 using 66983-1-Ig (same clone as 66983-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 66983-1-Ig (TRPV1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66983-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HUVEC using 66983-1-Ig (same clone as 66983-1-PBS)

  HUVEC cells were subjected to SDS PAGE followed by western blot with 66983-1-Ig (TRPV1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66983-1-PBS in a different storage buffer formulation.

TRPV1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66983-1-PBS

Clone No.1A3C9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

1A3C9, Osm 9 like TRP channel 1, Osm-9-like TRP channel 1, OTRPC1, Vanilloid receptor 1

---

Product Information

66983-1-PBS targets TRPV1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18683

  Product name: Recombinant human TRPV1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-203 aa of BC132820

  Sequence: MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETGKTCLLKAMLNLHDGQNTTIPLLLEIARQTDSLKELVNASYTDSYYKGQ

• Full Name: transient receptor potential cation channel, subfamily V, member 1
• Calculated Molecular Weight: 839 aa, 95 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC132820
• Gene Symbol: TRPV1
• Gene ID (NCBI): 7442
• RRID: AB_2882302
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8NER1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRPV1, also named as VR1 or OTRPC1, belongs to the transient receptor potential (TRP) family and TRPV subfamily (PMID: 17579562). TRPV1 is a ligand-activated non-selective calcium permeant cation channel expressed predominantly by sensory neurons (PMID: 10821274). It is involved in detection of noxious chemical and thermal stimuli. TRPV1 plays an important role in inflammatory thermal hyperalgesia (PMID: 10764638; 10821274).