TRX2/TXN2 Recombinant monoclonal antibody, PBS Only (Capture)

TRX2/TXN2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 85212-2-PBS
Clone No.242707H4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, monkey

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

TRX2, MT TRX, MTRX, Mt-Trx, Thioredoxin 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85212-2-PBS targets TRX2/TXN2 as part of a matched antibody pair:

MP01917-1: 85212-2-PBS capture and 85212-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, monkey
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3640

Product name: Recombinant human TRX2,TXN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-166 aa of BC013726

Sequence: MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG

Predict reactive species
Full Name thioredoxin 2
Calculated Molecular Weight 166 aa, 18 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC013726
Gene Symbol Thioredoxin 2
Gene ID (NCBI) 25828
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99757
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TXN2 (Thioredoxin-2) is also named as TRX2, MTRX, Mt-TRX, and regulates the mitochondrial redox state and plays an important role in cell proliferation. It has been shown that cells conditionally deficient in Trx2 undergo apoptosis in the absence of exogenous stress, accompanied by an accumulation of intracellular ROS, the activation of caspase 9 and caspase 3, and the release of cytochrome c into the cytosol. (PMID: 18441302).

Loading...
||
New chat Able
正在加载,请稍候...