TSC22D1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TSC22D1 Polyclonal antibody, PBS Only (10214-1-PBS)

• 

  WB analysis of human brain using 10214-1-Ig (same clone as 10214-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 10214-1-Ig (TSC22D1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10214-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 10214-1-Ig (same clone as 10214-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10214-1-Ig (TSC22D1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10214-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 10214-1-Ig (same clone as 10214-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 10214-1-Ig (TSC22D1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10214-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat brain using 10214-1-Ig (same clone as 10214-1-PBS)

  IP result of anti-TSC22D1 (IP:10214-1-Ig, 4ug; Detection:10214-1-Ig 1:500) with rat brain tissue lysate 4000ug. This data was developed using the same antibody clone with 10214-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 10214-1-Ig (same clone as 10214-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 10214-1-Ig (TSC22D1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10214-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 10214-1-Ig (same clone as 10214-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10214-1-Ig (TSC22D1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10214-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 10214-1-Ig (same clone as 10214-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 10214-1-Ig (TSC22D1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10214-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 10214-1-Ig (same clone as 10214-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10214-1-Ig (TSC22D1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10214-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 10214-1-Ig (same clone as 10214-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 10214-1-Ig (TSC22D1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10214-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 10214-1-Ig (same clone as 10214-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 10214-1-Ig (TSC22D1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10214-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 10214-1-Ig (same clone as 10214-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using TSC22D1 antibody (10214-1-Ig) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 10214-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TSC22D1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 10214-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

RP11 269C23.2, Regulatory protein TSC-22, Regulatory protein TSC 22, KIAA1994, HUCEP-2

---

Product Information

10214-1-PBS targets TSC22D1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0287

  Product name: Recombinant human TSC22D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-144 aa of BC000456

  Sequence: KSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA

• Full Name: TSC22 domain family, member 1
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC000456
• Gene Symbol: TSC22D1
• Gene ID (NCBI): 8848
• RRID: AB_2272193
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15714
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TSC22 domain family 1, transforming growth factor beta 1 induced transcript 4, (TSC22D1, synonyms: TSC22, TGFB1I4, MGC17597) is a member of a family of leucine zipper containing transcription factors with repressor activity and belongs to the large family of early response genes. TSC-22 regulates cell growth and differentiation, and cell death. Leucine zipper structure of TSC22 inhibits the anchorage independent growth of cancer cells. TSC-22 is also an important downstream component of peroxisome proliferator-activated receptor (PPAR) and TGF-beta signaling during intestinal epithelial cell differentiation. This antibody is a rabbit polyclonal antibody raised against an internal region of human TSC22D1.