• Featured Product
  • KD/KO Validated

TSFM Polyclonal antibody

TSFM Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 11701-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

EF-TsMt, EF-Ts, EF Tsmt, EF TS, COXPD3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, PC-3 cells, HEK-293 cells
Positive IHC detected inhuman colon cancer tissue, human kidney tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11701-1-AP targets TSFM in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2308

Product name: Recombinant human TSFM protein

Source: e coli.-derived, T-GST

Tag: GST

Domain: 1-346 aa of BC022862

Sequence: MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKVQWLTPVNLALWEAEAGGSLEGFLNSSELSGLPAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAETE

Predict reactive species
Full Name Ts translation elongation factor, mitochondrial
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC022862
Gene Symbol TSFM
Gene ID (NCBI) 10102
RRIDAB_2207953
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43897
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for TSFM antibody 11701-1-APDownload protocol
IHC protocol for TSFM antibody 11701-1-APDownload protocol
WB protocol for TSFM antibody 11701-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Biol Rep

Short-term regulation of TSFM level does not alter amyloidogenesis and mitochondrial function in type-specific cells

Authors - Xiao-Yun Li
  • KD Validated
humanWB

Cell Death Dis

piR-26441 inhibits mitochondrial oxidative phosphorylation and tumorigenesis in ovarian cancer through m6A modification by interacting with YTHDC1

Authors - Jing Yuan
Loading...
||
New chat Able
正在加载,请稍候...