TSGA13 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TSGA13 Polyclonal antibody, PBS Only (17326-1-PBS)

• 

  IHC staining of human testis using 17326-1-AP (same clone as 17326-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17326-1-AP (TSGA13 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17326-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17326-1-AP (same clone as 17326-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17326-1-AP (TSGA13 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17326-1-PBS in a different storage buffer formulation.

TSGA13 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 17326-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

17326-1-PBS targets TSGA13 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11305

  Product name: Recombinant human TSGA13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-275 aa of BC038415

  Sequence: MSQKRQTKFQNGKSKTSENSSAKREKGMVVNSKEISDAVGQSKFVLENLRHYTVHPNLAQYYKPLKATALQKFLAQNRKNTSFMLKVTQYDQDKTLLIMTNNPPPCSITQQDKESASKYFSKELLLKVMESHHQHKPTENLWLPRMPQKKKLRSKLKPIFPLILSDDPTSKREQWFRFSTDNDFKSEGKYSKVYALRTQKKMYPQLTFAPVHERDMRKDASKKSASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVIG

• Full Name: testis specific, 13
• Calculated Molecular Weight: 275 aa, 32 kDa
• GenBank Accession Number: BC038415
• Gene Symbol: TSGA13
• Gene ID (NCBI): 114960
• RRID: AB_2878382
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PP4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.