Use Able AI chat for product recommendations

TSKS Polyclonal antibody, PBS Only

TSKS Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33992-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

STK22 substrate 1, STK22S1, Testis-specific kinase substrate, Testis-specific serine kinase substrate, TSKS1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

33992-1-PBS targets TSKS in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag38588

Product name: Recombinant human TSKS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 328-592 aa of NM_021733.1

Sequence: EELRREVSSLTARWHQEEGAVQEALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERSAVSVASLRSELEGLGPLKPILEEFGRQFQNSRRGPDLSMNLDRSHQGNCARCASQGSQLSTESLQQLLDRALTSLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGTPPKQGGSAPEQ

Predict reactive species
Full Name testis-specific serine kinase substrate
Calculated Molecular Weight65kDa,592aa
Observed Molecular Weight65 kDa
GenBank Accession NumberNM_021733.1
Gene Symbol TSKS
Gene ID (NCBI) 60385
RRIDAB_3743135
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ9UJT2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Testis-specific serine kinase substrate (TSKS) was identified as a substrate for testis-specific serine kinase 1 (TSSK1) and TSSK2. Although these three proteins co-localize to nuage, double knockout (KO) mice lacking TSSK1 and TSSK2 (Tssk1/2 dKO mice) exhibit abnormal mitochondrial sheath formation, suggesting that these proteins and nuage are involved in mitochondrial sheath formation. However, the previous study observed abundant cytoplasm in the late spermatids at seminiferous tubule stage VIII of the Tssk1/2 dKO mouse. Furthermore, an interaction between TSKS and phosphatase protein PPP1CC2 was also reported previously. Protein phosphatase 1 catalytic subunit gamma (Ppp1cc) is a member of the PP1 family of protein phosphatases that encodes two splice isoforms: the ubiquitous Ppp1cc1 and the testis-specific Ppp1cc2. Ppp1cc knockout (KO) male mice also exhibit malformed mitochondrial sheath formation. These data indicate that the kinase and phosphatase of TSKS are involved in the formation of the mitochondrial sheath (PMID: 36881620).

Loading...
||
New chat

Able

正在加载,请稍候...