APC Anti-Human TSLP Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• APC Anti-Human TSLP Rabbit Recombinant Antibody (APC-98247)

TSLP Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. APC-98247

Clone No.241821B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

241821B2, Thymic stromal lymphopoietin

• 

  FC experiment of Human immature monocyte-derived dendritic cells using APC-98247

  1x10^6 human immature monocyte-derived dendritic cells were intracellularly stained with 5 ul APC Anti-Human TSLP Rabbit RecAb (APC-98247, Clone: 241821B2) (red) or APC Rabbit IgG Isotype Control Recombinant Antibody (APC-98136, Clone: 240953C9) (blue). Cells were incubated with FC Receptor Block prior to staining. Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC (Intra) detected in: human immature monocyte-derived dendritic cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-98247 targets TSLP in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1238

  Product name: Recombinant Human TSLP protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-10*His

  Domain: 29-159 aa of NM_033035.5

  Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

• Full Name: thymic stromal lymphopoietin
• Calculated Molecular Weight: 18 kDa
• GenBank Accession Number: NM_033035.5
• Gene Symbol: TSLP
• Gene ID (NCBI): 85480
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q969D9-1
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

TSLP is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain, it mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Another isoform of this protein may act as an antimicrobial peptide in the oral cavity and on the skin (PMID: 24850429).