Tested Applications
| Positive FC (Intra) detected in | human immature monocyte-derived dendritic cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension |
| This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
APC-98247 targets TSLP in FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1238 Product name: Recombinant Human TSLP protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 29-159 aa of NM_033035.5 Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ Predict reactive species |
| Full Name | thymic stromal lymphopoietin |
| Calculated Molecular Weight | 18 kDa |
| GenBank Accession Number | NM_033035.5 |
| Gene Symbol | TSLP |
| Gene ID (NCBI) | 85480 |
| Conjugate | APC Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 650 nm / 660 nm |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q969D9-1 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
TSLP is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain, it mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Another isoform of this protein may act as an antimicrobial peptide in the oral cavity and on the skin (PMID: 24850429).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for APC TSLP antibody APC-98247 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

