TSNAX Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TSNAX Polyclonal antibody, PBS Only (11040-1-PBS)

• 

  WB analysis using 11040-1-AP (same clone as 11040-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11040-1-AP (TSNAX antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11040-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 11040-1-AP (same clone as 11040-1-PBS)

  IP result of anti-TSNAX (IP:11040-1-AP, 4ug; Detection:11040-1-AP 1:300) with HeLa cells lysate 2400ug. This data was developed using the same antibody clone with 11040-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11040-1-AP (same clone as 11040-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11040-1-AP (TSNAX antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11040-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 11040-1-AP (same clone as 11040-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using TSNAX antibody (11040-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11040-1-PBS in a different storage buffer formulation.

TSNAX Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11040-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

translin associated factor X, Translin associated protein X, Translin-associated factor X, Translin-associated protein X, TRAX

---

Product Information

11040-1-PBS targets TSNAX in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1507

  Product name: Recombinant human TSNAX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-290 aa of BC011797

  Sequence: MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS

• Full Name: translin-associated factor X
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC011797
• Gene Symbol: TSNAX
• Gene ID (NCBI): 7257
• RRID: AB_2303821
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99598
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.