TSPAN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TSPAN1 Polyclonal antibody, PBS Only (16058-1-PBS)

• 

  WB analysis using 16058-1-AP (same clone as 16058-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16058-1-AP (TSPAN1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16058-1-AP (same clone as 16058-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16058-1-AP (TSPAN1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 16058-1-AP (same clone as 16058-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 16058-1-AP (TSPAN1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat colon using 16058-1-AP (same clone as 16058-1-PBS)

  rat colon tissue were subjected to SDS PAGE followed by western blot with 16058-1-AP (TSPAN1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 16058-1-AP (same clone as 16058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 16058-1-AP (TSPAN1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 16058-1-AP (same clone as 16058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 16058-1-AP (TSPAN1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16058-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TSPAN1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16058-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

16058-1-PBS targets TSPAN1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8786

  Product name: Recombinant human TSPAN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-215 aa of BC013404

  Sequence: MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTV

• Full Name: tetraspanin 1
• Calculated Molecular Weight: 241 aa, 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC013404
• Gene Symbol: TSPAN1
• Gene ID (NCBI): 10103
• RRID: AB_2878210
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60635
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TSPAN1 is a membrane protein of the tetraspanin superfamily, which is characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. Altered TSPAN1 expression has been associated with the progression of some neoplasms including hepatocellular carcinoma, colorectal, gastric, and breast cancers (PMID: 20890423; 19437569; 18822690; 20680643).