TSPAN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TSPAN2 Polyclonal antibody, PBS Only (20463-1-PBS)

• 

  WB analysis using 20463-1-AP (same clone as 20463-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20463-1-AP (TSPAN2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20463-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 20463-1-AP (same clone as 20463-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 20463-1-AP (TSPAN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20463-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HL-60 using 20463-1-AP (same clone as 20463-1-PBS)

  IP result of anti-TSPAN2 (IP:20463-1-AP, 4ug; Detection:20463-1-AP 1:500) with HL-60 cells lysate 960ug. This data was developed using the same antibody clone with 20463-1-PBS in a different storage buffer formulation.

TSPAN2 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 20463-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

20463-1-PBS targets TSPAN2 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14299

  Product name: Recombinant human TSPAN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 101-199 aa of BC021675

  Sequence: AEVTTGVFAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQLIGIVGIGIAGL

• Full Name: tetraspanin 2
• Calculated Molecular Weight: 221 aa, 24 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC021675
• Gene Symbol: TSPAN2
• Gene ID (NCBI): 10100
• RRID: AB_2878691
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60636
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TSPAN2 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. It has been reported that TSPAN2 is involved in cell invasion and motility during lung cancer progression (PMID: 24726368). TSPAN2 enhances cell motility and invasiveness by assisting CD44 in scavenging intracellular reactive oxygen species.