Home
Products
Primary Antibodies
TSPAN31 Polyclonal antibody, PBS Only (21987-1-PBS)

Filter: AllWBIHC

WB analysis of HeLa using 21987-1-AP (same clone as 21987-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 21987-1-AP (TSPAN31 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21987-1-PBS in a different storage buffer formulation.
WB analysis using 21987-1-AP (same clone as 21987-1-PBS)
Rat heart tissue was subjected to SDS PAGE followed by western blot with 21987-1-AP (TSPAN31 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21987-1-PBS in a different storage buffer formulation.
WB analysis of HepG2 using 21987-1-AP (same clone as 21987-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 21987-1-AP (TSPAN31 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21987-1-PBS in a different storage buffer formulation.
WB analysis of PC-3 using 21987-1-AP (same clone as 21987-1-PBS)
PC-3 cells were subjected to SDS PAGE followed by western blot with 21987-1-AP (TSPAN31 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21987-1-PBS in a different storage buffer formulation.
WB analysis of mouse skeletal muscle using 21987-1-AP (same clone as 21987-1-PBS)
mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 21987-1-AP (TSPAN31 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21987-1-PBS in a different storage buffer formulation.
IHC staining of human skeletal muscle using 21987-1-AP (same clone as 21987-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 21987-1-AP (TSPAN31 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 21987-1-PBS in a different storage buffer formulation.
IHC staining of human skeletal muscle using 21987-1-AP (same clone as 21987-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 21987-1-AP (TSPAN31 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 21987-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 21987-1-AP (same clone as 21987-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 21987-1-AP (TSPAN31 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 21987-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 21987-1-AP (same clone as 21987-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 21987-1-AP (TSPAN31 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 21987-1-PBS in a different storage buffer formulation.

TSPAN31 Polyclonal antibody, PBS Only

Name: TSPAN31 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21987-1-PBS

TSPAN31 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21987-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Sarcoma-amplified sequence, SAS, Tetraspanin-31, Tspan-31

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

21987-1-PBS targets TSPAN31 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag17138 Product name: Recombinant human TSPAN31 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 91-180 aa of BC010377 Sequence: VISCSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGL Predict reactive species
Full Name	tetraspanin 31
Calculated Molecular Weight	210 aa, 23 kDa
Observed Molecular Weight	30 kDa
GenBank Accession Number	BC010377
Gene Symbol	TSPAN31
Gene ID (NCBI)	6302
RRID	AB_2878962
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q12999
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Tetraspanin-31 (TSPAN31) belongs to the tetraspanin (TM4SF) family, also known as the transmembrane 4 (TM4) superfamily, which is a family of transmembrane proteins with 33 mammalian members. These proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth, and motility. Tetraspanin-31 is thought to be involved in growth-related cellular processes. The experimentally determined molecular mass of 30 kDa is larger than the calculated molecular mass of 23 kDa, which could be a result of post-translational modifications.