TSPAN32 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TSPAN32 Polyclonal antibody, PBS Only (20320-1-PBS)

• 

  WB analysis of mouse spleen using 20320-1-AP (same clone as 20320-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 20320-1-AP (TSPAN32 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20320-1-PBS in a different storage buffer formulation.

TSPAN32 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20320-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

20320-1-PBS targets TSPAN32 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14174

  Product name: Recombinant human TSPAN32 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-202 aa of BC016693

  Sequence: LAFCAQVQVVFWRLHSPTQVEDAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAREDCLQGIRSFLRTHQQVASSLT

• Full Name: tetraspanin 32
• Calculated Molecular Weight: 320 aa, 35 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC016693
• Gene Symbol: TSPAN32
• Gene ID (NCBI): 10077
• RRID: AB_2878672
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QS1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.