TSPAN33 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TSPAN33 Polyclonal antibody, PBS Only (14329-1-PBS)

• 

  WB analysis of human brain using 14329-1-AP (same clone as 14329-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 14329-1-AP (TSPAN33 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14329-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human plasma using 14329-1-AP (same clone as 14329-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 14329-1-AP (TSPAN33 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14329-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 14329-1-AP (same clone as 14329-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 14329-1-AP (TSPAN33 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14329-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 14329-1-AP (same clone as 14329-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 14329-1-AP (TSPAN33 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14329-1-PBS in a different storage buffer formulation.

TSPAN33 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14329-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14329-1-PBS targets TSPAN33 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5597

  Product name: Recombinant human TSPAN33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 116-236 aa of BC044244

  Sequence: FVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNL

• Full Name: tetraspanin 33
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 64-72 kDa
• GenBank Accession Number: BC044244
• Gene Symbol: TSPAN33
• Gene ID (NCBI): 340348
• RRID: AB_10644331
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UF1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TSPAN33 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN33 belongs to the TSPANC8 subfamily, which also include TSPAN5, TSPAN10, TSPAN14, TSPAN15, and TSPAN17. It has been reported that TSPANC8 tetraspanins interact with ADAM10 and have a conserved function in the regulation of ADAM10 trafficking and activity, thereby positively regulating Notch receptor activation (PMID: 23091066; 23035126).