TSPAN8 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TSPAN8 Recombinant monoclonal antibody (87700-3-RR)

• 

  WB analysis using 87700-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87700-3-RR (TSPAN8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 87700-3-RR

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 87700-3-RR (TSPAN8 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TSPAN8 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87700-3-RR

Clone No.252991H1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CO 029, tetraspanin 8, Tetraspanin-8, TM4SF3, Tspan 8

---

Tested Applications

• Positive WB detected in: Calu-3 cells, Ramos cells, LoVo cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87700-3-RR targets TSPAN8 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7574

  Product name: Recombinant human TSPAN8 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 110-205 aa of NM_004616.2

  Sequence: KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN

• Full Name: tetraspanin 8
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: NM_004616.2
• Gene Symbol: TSPAN8
• Gene ID (NCBI): 7103
• RRID: AB_3745705
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P19075
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TSPAN8 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN8 and CD151 coordinately promote metastasis, where Tspan8 overrides the adhesive features of CD151 by recruiting integrins out of adhesion into motility promoting complexes (PMID: 23683890). TSPAN8 contributes to molecular pathways of exosome-induced endothelial cell activation (PMID: 20124479).