• Featured Product
  • KD/KO Validated

TTC9C Recombinant monoclonal antibody, PBS Only (Capture)

TTC9C Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 84611-2-PBS
Clone No.242061D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

242061D12, Tetratricopeptide repeat protein 9C, TPR repeat protein 9C

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84611-2-PBS targets TTC9C as part of a matched antibody pair:

MP01448-1: 84611-2-PBS capture and 84611-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag37081

Product name: Recombinant human TTC9C protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-171 aa of BC032123

Sequence: MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPKDANVRRYLQLTQSELSSYHRKEKQLYLGMFG

Predict reactive species
Full Name tetratricopeptide repeat domain 9C
Observed Molecular Weight19-22 kDa
GenBank Accession NumberBC032123
Gene Symbol TTC9C
Gene ID (NCBI) 283237
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N5M4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TTC9 family belongs to tetratricopeptide repeat (TPR)-containing proteins family (PMID: 35949301).The TPR motifs are arranged in antiparallel α-helical hairpins which are clustered to form flexible grooved interfaces. Members in TRP-containing proteins family are involved in a diverse range of biological functions, including cell cycle control, transcription, protein folding, and steroid receptor signaling (PMID: 15497498;PMID: 10786835).

Loading...
||
New chat Able
正在加载,请稍候...