TTC9C Recombinant monoclonal antibody

• 

  WB analysis using 84611-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84611-2-RR (TTC9C antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 84611-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84611-2-RR (TTC9C antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 84611-2-RR

  WB result of TTC9C antibody (84611-2-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TTC9C transfected HeLa cells.

• 

  IHC staining of mouse testis using 84611-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 84611-2-RR (TTC9C antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 84611-2-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using TTC9C antibody (84611-2-RR, Clone: 242061D12 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84611-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84611-2-RR against Human TTC9C were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

TTC9C Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 84611-2-RR

Clone No.242061D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

242061D12, Tetratricopeptide repeat protein 9C, TPR repeat protein 9C

---

Tested Applications

• Positive WB detected in: THP-1 cells, HeLa cells, mouse thymus tissue, mouse skin tissue, mouse stomach tissue, human kidney tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84611-2-RR targets TTC9C in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag37081

  Product name: Recombinant human TTC9C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-171 aa of BC032123

  Sequence: MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPKDANVRRYLQLTQSELSSYHRKEKQLYLGMFG

• Full Name: tetratricopeptide repeat domain 9C
• Observed Molecular Weight: 19-22 kDa
• GenBank Accession Number: BC032123
• Gene Symbol: TTC9C
• Gene ID (NCBI): 283237
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N5M4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TTC9 family belongs to tetratricopeptide repeat (TPR)-containing proteins family (PMID: 35949301).The TPR motifs are arranged in antiparallel α-helical hairpins which are clustered to form flexible grooved interfaces. Members in TRP-containing proteins family are involved in a diverse range of biological functions, including cell cycle control, transcription, protein folding, and steroid receptor signaling (PMID: 15497498;PMID: 10786835).