• Featured Product
  • KD/KO Validated

Gamma Tubulin Polyclonal antibody

This Gamma Tubulin antibody is a rabbit polyclonal antibody that targets Gamma Tubulin in WB, IHC, FC (Intra), IP, ELISA and is suitable for human, mouse, rat, canine samples.
Cat No. 15176-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

TUBG1, Tubulin gamma 1 chain, TUBG, GCP-1, Gamma-tubulin complex component 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Transfected HEK-293 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman prostate cancer tissue, human prostate hyperplasia tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15176-1-AP targets Gamma Tubulin in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.

Tested Reactivity human, mouse, rat, canine
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7070

Product name: Recombinant human tubulin-gamma protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 103-451 aa of BC000619

Sequence: NWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ

Predict reactive species
Full Name tubulin, gamma 1
Calculated Molecular Weight 51 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC000619
Gene Symbol Gamma Tubulin
Gene ID (NCBI) 7283
RRIDAB_2878113
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23258
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure.

Protocols

Product Specific Protocols
WB protocol for Gamma Tubulin antibody 15176-1-APDownload protocol
IHC protocol for Gamma Tubulin antibody 15176-1-APDownload protocol
IP protocol for Gamma Tubulin antibody 15176-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cancer Cell

Hippo Signaling Suppresses Cell Ploidy and Tumorigenesis through Skp2.

Authors - Shihao Zhang
humanIF,WB

Nat Commun

INTS13 variants causing a recessive developmental ciliopathy disrupt assembly of the Integrator complex

Authors - Lauren G. Mascibroda
mouseIF

PLoS Biol

Noncoding RNA Ginir functions as an oncogene by associating with centrosomal proteins.

Authors - Suchismita Panda
mouseWB

Cell Death Differ

Haploinsufficiency of GCP4 induces autophagy and leads to photoreceptor degeneration due to defective spindle assembly in retina.

Authors - Zhigang Li
humanIF

Br J Pharmacol

NL13, a novel curcumin analogue and polo like kinase 4 inhibitor, induces cell cycle arrest and apoptosis in prostate cancer models

Authors - Xinyi Qiao
humanWB

Elife

LUZP1, a novel regulator of primary cilia and the actin cytoskeleton, is a contributing factor in Townes-Brocks Syndrome.

Authors - Laura Bozal-Basterra

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Deng (Verified Customer) (07-22-2022)

The cells were fixed with cold methanol.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1 : 500
  • Cell Tissue Type: Human RPE1 cells
Gamma Tubulin Antibody Immunofluorescence validation (1 : 500 dilution) in Human RPE1 cells (Cat no:15176-1-AP)
FH

Iru (Verified Customer) (06-17-2021)

It works well with O/N incubation.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Fallopian tube epithelial cells
Gamma Tubulin Antibody Western Blot validation (1:1000 dilution) in Fallopian tube epithelial cells (Cat no:15176-1-AP)
FH

Christopher (Verified Customer) (07-02-2019)

Very fast delivery I think it arrived in a matter of days which is quick compared to some other companies.Westerns worked really well, so it must be good, over all really pleased with this purchase

  • Applications: Western Blot,
FH

Boyan (Verified Customer) (01-29-2019)

Excellent. Works quite well both for WB and IF.

  • Applications: Western Blot, Immunofluorescence,
Loading...
||
New chat Able
正在加载,请稍候...