TUBG2 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TUBG2 Recombinant monoclonal antibody, PBS Only (87516-1-PBS)

TUBG2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 87516-1-PBS Copied!

Clone No. 252833C10

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Gamma 2 tubulin, Gamma-2-tubulin, GTU-88, Tubulin gamma 2 chain, Tubulin gamma-2 chain

• 

  WB analysis using 87516-1-RR (same clone as 87516-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87516-1-RR (TUBG2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87516-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 87516-1-RR (same clone as 87516-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 87516-1-RR (TUBG2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87516-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 87516-1-RR (same clone as 87516-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TUBG2 antibody (87516-1-RR, Clone: 252833C10 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87516-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TUBG2 in ?

Chat with Able

---

Product Information

87516-1-PBS targets TUBG2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, canine samples.

• Tested Reactivity: human, mouse, rat, canine
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27728

  Product name: Recombinant human TUBG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 358-451 aa of BC051890

  Sequence: VALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYISWGTQEQ

• Full Name: tubulin, gamma 2
• Calculated Molecular Weight: 451 aa, 51 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC051890
• Gene Symbol: TUBG2
• Gene ID (NCBI): 27175
• RRID: AB_3745593
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NRH3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TUBG2 (γ-tubulin 2) is a member of the tubulin family primarily expressed at the centrioles and spindle poles, and is highly homologous to TUBG1. As a core component of the γ-TuRC (γ-tubulin ring complex), it recruits tubulin dimers by binding to adaptor proteins such as γ-TuNA, providing a template for microtubule nucleation and playing a crucial role in the organization of centrosome microtubules and the proper assembly of the spindle.