Tested Applications
| Positive WB detected in | HeLa cells, T-47D cells, SK-BR-3 cells, MDCK cells, COS-7 cells, mouse cerebellum tissue, rat cerebellum tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
87516-1-RR targets TUBG2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, canine samples.
| Tested Reactivity | human, mouse, rat, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag27728 Product name: Recombinant human TUBG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 358-451 aa of BC051890 Sequence: VALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYISWGTQEQ Predict reactive species |
| Full Name | tubulin, gamma 2 |
| Calculated Molecular Weight | 451 aa, 51 kDa |
| Observed Molecular Weight | 51 kDa |
| GenBank Accession Number | BC051890 |
| Gene Symbol | TUBG2 |
| Gene ID (NCBI) | 27175 |
| RRID | AB_3745593 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NRH3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TUBG2 antibody 87516-1-RR | Download protocol |
| WB protocol for TUBG2 antibody 87516-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



