TULP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TULP1 Polyclonal antibody (18971-1-AP)

TULP1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18971-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

TUBL1, Tubby-related protein 1, Tubby-like protein 1

• 

  WB analysis of human brain using 18971-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 18971-1-AP (TULP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18971-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18971-1-AP (TULP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 18971-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 18971-1-AP (TULP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human eye using 18971-1-AP

  Immunohistochemical analysis of paraffin-embedded human eye using 18971-1-AP (TULP1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human eye using 18971-1-AP

  Immunohistochemical analysis of paraffin-embedded human eye using 18971-1-AP (TULP1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TULP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Y79 cells, human brain tissue, mouse retina tissue
• Positive IHC detected in: human eye tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18971-1-AP targets TULP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5598

  Product name: Recombinant human TULP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 139-489 aa of BC032714

  Sequence: TKMRKTKKKGSGEADKDPSGSPASARKSPAAMFLVGEGSPDKKALKKKGTPKGARKEEEEEEEAATVIKNSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAPQGRTVRCRLTRDKKGMDRGMYPSYFLHLDTEKKVFLLAGRKRKRSKTANYLISIDPTNLSRGGENFIGKLRSNLLGNRFTVFDNGQNPQRGYSTNVASLRQELAAVIYETNVLGFRGPRRMTVIIPGMSAENERVPIRPRNASDGLLVRWQNKTLESLIELHNKPPVWNDDSGSYTLNFQGRVTQASVKNFQIVHADDPDYIVLQFGRVAEDAFTLDYRYPLCALQAFAIALSSFDGKLACE

• Full Name: tubby like protein 1
• Calculated Molecular Weight: 489 aa, 55 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC032714
• Gene Symbol: TULP1
• Gene ID (NCBI): 7287
• RRID: AB_2211412
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00294
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TULP1, also known as RP14, LCA15, and TUBL1, is a member of the tubby-like protein (TULP) family. TULP1 is expressed exclusively in the retina and is essential for the transport of rhodopsin from its site of synthesis in the inner segments through the connecting cilium to the outer segments(PMID: 17620573). Mutations in TULP1 are associated with Retinitis pigmentosa 14 and Leber congenital amaurosis-15(PMID: 17620573, 17962469).

Publications

What published studies show

The TULP1 Polyclonal antibody (Cat# 18971-1-AP) has 1 total citation. It appears in Scientific Reports (2024), where it was used for Western Blot in a mouse model. The research field is retinal degeneration, specifically proteomic identification of retinitis pigmentosa-associated proteins in a Pde6b mutation mouse model.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Rep; Proteomics identifies multiple retinitis pigmentosa associated proteins involved in retinal degeneration in a mouse model bearing a Pde6b mutation; Authors - Mingzhu Yang