Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Mouse TWEAKR/CD266 Rabbit Recombinant Antibody, PBS Only (98382-2-PBS)

Anti-Mouse TWEAKR/CD266 Rabbit Recombinant Antibody, PBS Only

Name: Anti-Mouse TWEAKR/CD266 Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98382-2-PBS-1MG

TWEAKR/CD266 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98382-2-PBS

Clone No. 241646F11

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Synonyms

TNFRSF12, TWEAK R, CD266, FGF-inducible 14, Fgfrp2

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFCAffinity

FC experiment of Transfected HEK-293T using 98382-2-RR (same clone as 98382-2-PBS)
1x10^6 HEK-293T cells or TWEAKR/CD266 transfected HEK-293T cells were stained with 0.25 ug Anti-Mouse TWEAK R/TNFRSF12 Rabbit RecAb (98382-2-RR, Clone:241646F11) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98382-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HEK-293T cells or TWEAKR/CD266 transfected HEK-293T cells were stained with 0.25 ug Anti-Mouse TWEAK R/TNFRSF12 Rabbit RecAb (98382-2-RR, Clone:241646F11) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98382-2-PBS in a different storage buffer formulation.
FC experiment of Transfected HEK-293T using 98382-2-RR (same clone as 98382-2-PBS)
1x10^6 HEK-293T cells(left) or TWEAK R/TNFRSF12 transfected HEK-293T cells(right) were stained with 0.25 ug Anti-Mouse TWEAK R/TNFRSF12 Rabbit RecAb (98382-2-RR, Clone:241646F11)(red) , or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98382-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HEK-293T cells(left) or TWEAK R/TNFRSF12 transfected HEK-293T cells(right) were stained with 0.25 ug Anti-Mouse TWEAK R/TNFRSF12 Rabbit RecAb (98382-2-RR, Clone:241646F11)(red) , or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98382-2-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 98382-2-RR
Biolayer interferometry (BLl) kinetic assays of 98382-2-RR against Mouse TWEAKR/CD266 were performed. The affinity constant is 0.983 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TWEAKR/CD266 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98382-2-PBS targets TWEAKR/CD266 in FC applications and shows reactivity with mouse samples.

Tested Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg1838 Product name: Recombinant Mouse TWEAKR/CD266 protein (rFc Tag) (HPLC-verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 28-80 aa of NM_013749.2 Sequence: EQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRLLWP Predict reactive species
Full Name	tumor necrosis factor receptor superfamily, member 12a
Calculated Molecular Weight	14kDa
GenBank Accession Number	NM_013749.2
Gene Symbol	Tnfrsf12a
Gene ID (NCBI)	27279
RRID	AB_3746027
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q9CR75
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

TWEAKR (also known as CD266, FN14, TNFRSF12A) is a member of the TNF receptor superfamily which is activated by its ligand, the cytokine TWEAK (TNFSF12). TWEAKR is the smallest member of the TNFR superfamily. TweakR was first described as an FGF-inducible gene that played a role in fibroblast adhesion and migration. Subsequently, the induction of TweakR expression by other growth factors and/or upon tissue injury was observed in multiple cell types, including hepatocytes, endothelial cells, adipocytes, and cardiomyocytes. (PMID: 23073510, PMID: 24409185)