TXNL4B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TXNL4B Polyclonal antibody, PBS Only (12927-1-PBS)

• 

  WB analysis of HEK-293 using 12927-1-AP (same clone as 12927-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12927-1-AP (TXNL4B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12927-1-PBS in a different storage buffer formulation.

TXNL4B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12927-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

12927-1-PBS targets TXNL4B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3620

  Product name: Recombinant human TXNL4B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-149 aa of BC009646

  Sequence: MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

• Full Name: thioredoxin-like 4B
• Calculated Molecular Weight: 149 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC009646
• Gene Symbol: TXNL4B
• Gene ID (NCBI): 54957
• RRID: AB_2877893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX01
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TXNL4B(Thioredoxin-like protein 4B) is also named as DIM2, DLP and belongs to the DIM1 family. It is implicated in not only cell cycle progression but also in a more specific molecular process such as pre-mRNA splicing. It is required for S/G(2) transition.