• Featured Product
  • KD/KO Validated

TXNRD1 Monoclonal antibody

TXNRD1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67728-1-Ig
Clone No.1B10C4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

TRXR1, 1B10C4, EC:1.11.1.2, EC:1.8.1.9, Gene associated with retinoic and IFN-induced mortality 12 protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHSC-T6 cells, A549 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67728-1-Ig targets TXNRD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, chicken
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30071

Product name: Recombinant human TXNRD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 199-500 aa of BC018122

Sequence: SYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG

Predict reactive species
Full Name thioredoxin reductase 1
Calculated Molecular Weight 55 kDa
Observed Molecular Weight50-70 kDa
GenBank Accession NumberBC018122
Gene Symbol TXNRD1
Gene ID (NCBI) 7296
RRIDAB_2882914
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ16881
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Thioredoxin reductase-1 (TXNRD1) is uniquely capable of utilizing electrons from NADPH to recover the reduced state of TRX1. Interestingly, TXNRD1 is upregulated in many human malignancies and promotes cancer progression, and attenuation of TXNRD1 levels effectively suppresses the growth of tumor cells (PMID: 31384178). TXNRD1 is also upregulated in many human malignancies and functions as a prognostic factor for many tumors, such as oral squamous cell carcinomas, lung cancer, breast cancer, and astrocytomas. TXNRD1 protein levels were analyzed by inmmunoblotting. Bands of ~55 kDa for TXNRD1 were observed. IHC analysis suggested TXNRD1 was mainly located in the cytoplasm. (PMID: 28536696, PMID: 20584310)

Protocols

Product Specific Protocols
IF protocol for TXNRD1 antibody 67728-1-IgDownload protocol
IHC protocol for TXNRD1 antibody 67728-1-IgDownload protocol
WB protocol for TXNRD1 antibody 67728-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer

Authors - Rong Wang
humanWB

Redox Biol

Guiding bar motif of thioredoxin reductase 1 modulates enzymatic activity and inhibitor binding by communicating with the co-factor FAD and regulating the flexible C-terminal redox motif

Authors - Wuyang Shi
mouse,humanWB,IF

Redox Biol

Mecheliolide elicits ROS-mediated ERS driven immunogenic cell death in hepatocellular carcinoma.

Authors - Zhongren Xu
mouseIF

J Immunother Cancer

Nanoparticle delivery of miR-21-3p sensitizes melanoma to anti-PD-1 immunotherapy by promoting ferroptosis.

Authors - Weinan Guo
humanWB

Front Oncol

A Robust Metabolic Enzyme-Based Prognostic Signature for Head and Neck Squamous Cell Carcinoma.

Authors - Zizhao Mai
  • KD Validated
humanWB

Front Oncol

Bioinformatics-Driven Identification of p62 as A Crucial Oncogene in Liver Cancer.

Authors - Ling Wang
Loading...
||
New chat Able
正在加载,请稍候...