TYK2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67411-1-Ig (same clone as 67411-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67411-1-Ig (TYK2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67411-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67411-1-Ig (same clone as 67411-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67411-1-Ig (TYK2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67411-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67411-1-Ig (same clone as 67411-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67411-1-Ig (TYK2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67411-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67411-1-Ig (same clone as 67411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67411-1-Ig (TYK2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67411-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67411-1-Ig (same clone as 67411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67411-1-Ig (TYK2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67411-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67411-1-Ig (same clone as 67411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67411-1-Ig (TYK2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67411-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67411-1-Ig (same clone as 67411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67411-1-Ig (TYK2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67411-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67411-1-Ig (same clone as 67411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67411-1-Ig (TYK2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67411-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67411-1-Ig (same clone as 67411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67411-1-Ig (TYK2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67411-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67411-1-Ig (same clone as 67411-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TYK2 antibody (67411-1-Ig, Clone: 1E1A10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 67411-1-PBS in a different storage buffer formulation.

TYK2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67411-1-PBS

Clone No.1E1A10

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

JTK1, TYK2, tyrosine kinase 2

---

Product Information

67411-1-PBS targets TYK2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9442

  Product name: Recombinant human TYK2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 901-1187 aa of BC014243

  Sequence: RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC

• Full Name: tyrosine kinase 2
• Calculated Molecular Weight: 1187 aa, 134 kDa
• Observed Molecular Weight: 134 kDa
• GenBank Accession Number: BC014243
• Gene Symbol: TYK2
• Gene ID (NCBI): 7297
• RRID: AB_2882652
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29597
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.