Thioredoxin 1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Thioredoxin 1 Polyclonal antibody (14999-1-AP)

• Featured Product
• KD/KO Validated

Thioredoxin 1 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 14999-1-AP

Publications(113)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (4)

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ELISA

Synonyms

thioredoxin, TXN, ADF, ATL-derived factor, Hom s Trx

• 

  WB analysis using 14999-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14999-1-AP (Thioredoxin 1 antibody) at dilution of 1:4500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14999-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14999-1-AP (Thioredoxin 1 antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14999-1-AP

  WB result of Thioredoxin 1 antibody (14999-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Thioredoxin transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 14999-1-AP

  IP result of anti-Thioredoxin 1 (IP:14999-1-AP, 4ug; Detection:14999-1-AP 1:6000) with HeLa cells lysate 1520 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 14999-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14999-1-AP (Thioredoxin 1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 14999-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 14999-1-AP (Thioredoxin 1 antibody) at dilution of 1:900 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 14999-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human Thioredoxin 1 (14999-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, K562 cells, MCF-7 cells, Jurkat cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver cancer tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:9000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14999-1-AP targets Thioredoxin 1 in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6989

  Product name: Recombinant human TXN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-105 aa of BC003377

  Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

• Full Name: thioredoxin
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC003377
• Gene Symbol: TXN
• Gene ID (NCBI): 7295
• RRID: AB_2272597
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10599
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Thioredoxin 1 (TXN), also known as TRDX, TRX, TRX1, ADF, and SASP, belongs to the thioredoxin family. It participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. TXN plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. TXN induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity. (PMID: 14691207; 16408020; 11118054; 35885063).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cancer Discov; Spatial Transcriptomics of Intraductal Papillary Mucinous Neoplasms of the Pancreas Identifies NKX6-2 as a Driver of Gastric Differentiation and Indolent Biological Potential; Authors - Marta Sans
mouse	WB,IP	Nat Commun; PDK4 drives abdominal aortic aneurysm by promoting smooth muscle cell metabolic reprogramming and NLRP3-mediated pyroptosis.; Authors - Li Zhao
human	WB	Nat Commun; Cordycepin prevents radiation ulcer by inhibiting cell senescence via NRF2 and AMPK in rodents.; Authors - Ziwen Wang
rat,mouse	WB,IF	Ageing Res Rev; Thioredoxin-1 inhibits the activation of IRE1 by targeting Hsp90/p-Cdc37 chaperone complex in Parkinson disease; Authors - Xiansi Zeng ; KD Validated
mouse	WB	Theranostics; TFE3, a potential therapeutic target for Spinal Cord Injury via augmenting autophagy flux and alleviating ER stress.; Authors - Kailiang Zhou
rat	WB,IF	Genes Dis; Role of thioredoxin-interacting protein in mediating endothelial dysfunction in hypertension; Authors - Ruiyu Wang

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Amandine (Verified Customer) (02-07-2024)

20ug of protein, denatured or not, PVDF membrane, fast transfert, primary antibody 1/5000 1h30 RT, secondary antibody 1/5000 2h RT. Chemiluminescence revelation 10sec

• Applications: Western Blot
• Primary Antibody Dilution: 1/5000
• Cell Tissue Type: ImCC

Thioredoxin 1 Antibody Western Blot validation (1/5000 dilution) in ImCC (Cat no:14999-1-AP)