Thrombospondin 1 Monoclonal antibody, PBS Only

Thrombospondin 1 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 67241-1-PBS
Clone No.2A3E1

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, mouse

Applications

WB, Indirect ELISA

THBS, THBS 1, THBS1, thrombospondin 1, Thrombospondin-1, TSP, TSP 1, TSP1, TSP-1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67241-1-PBS targets Thrombospondin 1 in WB, Indirect ELISA applications and shows reactivity with Human, rat, mouse samples.

Tested Reactivity Human, rat, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29129

Product name: Recombinant human THBS1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 25-250 aa of NM_003246

Sequence: GGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGS

Predict reactive species
Full Name thrombospondin 1
Calculated Molecular Weight 129 kDa
Observed Molecular Weight 160 kDa
GenBank Accession NumberNM_003246
Gene Symbol Thrombospondin 1
Gene ID (NCBI) 7057
RRIDAB_2882520
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP07996
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Thrombospondin 1(TSP-1), an extracellular matrix protein, is the first identified natural angiogenesis inhibitor. A variety of normal cells, including endothelial cells, fibroblasts, adipocytes, smooth muscle cells, monocytes, macrophages, and transformed cells such as malignant glioma cells, secrete Thrombospondin 1. It regulates cellular phenotype during tissue genesis and repair. It acts as a molecular facilitator by bringing together cytokines, growth factors, matrix components, membrane receptors and extracellular proteases. Thrombospondin 1 binds to a wide variety of integrin and non-integrin cell surface receptors. It is also a major activator of transforming growth factor (TGFβ1). Secreted TSP1 is a glycoprotein with a molecular mass of 150-180 kDa.

Loading...
||
New chat Able
正在加载,请稍候...