Thrombospondin 1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67241-1-Ig (same clone as 67241-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67241-1-Ig (THBS1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67241-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat spleen using 67241-1-Ig (same clone as 67241-1-PBS)

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 67241-1-Ig (THBS1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67241-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67241-1-Ig (same clone as 67241-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67241-1-Ig (Thrombospondin 1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67241-1-PBS in a different storage buffer formulation.

Thrombospondin 1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67241-1-PBS

Clone No.2A3E1

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, mouse

Applications

WB, Indirect ELISA

Synonyms

THBS, THBS 1, THBS1, thrombospondin 1, Thrombospondin-1, TSP, TSP 1, TSP1, TSP-1

---

Product Information

67241-1-PBS targets Thrombospondin 1 in WB, Indirect ELISA applications and shows reactivity with Human, rat, mouse samples.

• Tested Reactivity: Human, rat, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29129

  Product name: Recombinant human THBS1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-250 aa of NM_003246

  Sequence: GGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGS

• Full Name: thrombospondin 1
• Calculated Molecular Weight: 129 kDa
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: NM_003246
• Gene Symbol: Thrombospondin 1
• Gene ID (NCBI): 7057
• RRID: AB_2882520
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P07996
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Thrombospondin 1(TSP-1), an extracellular matrix protein, is the first identified natural angiogenesis inhibitor. A variety of normal cells, including endothelial cells, fibroblasts, adipocytes, smooth muscle cells, monocytes, macrophages, and transformed cells such as malignant glioma cells, secrete Thrombospondin 1. It regulates cellular phenotype during tissue genesis and repair. It acts as a molecular facilitator by bringing together cytokines, growth factors, matrix components, membrane receptors and extracellular proteases. Thrombospondin 1 binds to a wide variety of integrin and non-integrin cell surface receptors. It is also a major activator of transforming growth factor (TGFβ1). Secreted TSP1 is a glycoprotein with a molecular mass of 150-180 kDa.