TIM23 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82540-1-RR (same clone as 82540-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82540-1-RR (TIM23 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82540-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 82540-1-RR (same clone as 82540-1-PBS)

  IP result of anti-TIM23 (IP:82540-1-RR, 4ug; Detection:82540-1-RR 1:1000) with HeLa cells lysate 1280 ug. This data was developed using the same antibody clone with 82540-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 82540-1-RR (same clone as 82540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 82540-1-RR (TIM23 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82540-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 82540-1-RR (same clone as 82540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 82540-1-RR (TIM23 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82540-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 82540-1-RR (same clone as 82540-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TIM23 antibody (82540-1-RR, Clone: 1H16 ) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82540-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 82540-1-RR (same clone as 82540-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using TIM23 antibody (82540-1-RR, Clone: 1H16 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82540-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82540-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82540-1-RR against Human Tim23 were performed. The affinity constant is below 1 pM.

TIM23 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 82540-1-PBS

Clone No.1H16

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

TIMM23, 1H16, Mitochondrial import inner membrane translocase subunit Tim23, TIMM 23

---

Product Information

82540-1-PBS targets TIM23 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1620

  Product name: Recombinant human Tim23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-208 aa of BC062707

  Sequence: MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFIPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL

• Full Name: translocase of inner mitochondrial membrane 23
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC062707
• Gene Symbol: TIMM23
• Gene ID (NCBI): 100287932
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14925
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Tim23, a key component of the mitochondrial preprotein translocase, is anchored in the inner membrane by its C-terminal domain and exposes an intermediate domain in the intermembrane space that functions as a presequence receptor. Tim23 is the main component of the translocation channel of the TIM23 complex. (PMID: 10830167, PMID: 25083920)