• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb™ APC Anti-Human Tissue Factor/CD142 Rabbit Recombinant Antibody

Tissue Factor/CD142 FcZero-rAbTM Recombinant Antibody for FC
Cat No. APC-FcA98104
Clone No.240784E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

CD142, Coagulation factor III, F3, Tissue factor, TF

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  APC
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inLPS treated human PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 μl per 10^6 cells in a 100 µl suspension or 5 μl per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98104 targets Tissue Factor/CD142 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1052

Product name: Recombinant Human Coagulation Factor III/Tissue Factor protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 33-251 aa of NM_001993.5

Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Predict reactive species
Full Name coagulation factor III (thromboplastin, tissue factor)
Calculated Molecular Weight33 kDa
GenBank Accession NumberNM_001993.5
Gene Symbol F3
Gene ID (NCBI) 2152
Conjugate APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 660 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13726-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named CD142, coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108).

Protocols

Product Specific Protocols
FC protocol for APC Tissue Factor/CD142 antibody APC-FcA98104Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...