Trehalase Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Trehalase Polyclonal antibody, PBS Only (21685-1-PBS)

• 

  WB analysis using 21685-1-AP (same clone as 21685-1-PBS)

  Mouse small intestine tissue lysate were subjected to SDS PAGE followed by western blot with 21685-1-AP (Trehalase antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21685-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human kidney using 21685-1-AP (same clone as 21685-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human kidney tissue using Trehalase antibody (21685-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21685-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human kidney using 21685-1-AP (same clone as 21685-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human kidney tissue using Trehalase antibody (21685-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21685-1-PBS in a different storage buffer formulation.

Trehalase Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 21685-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

Synonyms

TREH, Alpha,alpha trehalase, Alpha,alpha-trehalase, Alpha,alpha-trehalose glucohydrolase, EC:3.2.1.28

---

Product Information

21685-1-PBS targets Trehalase in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16246

  Product name: Recombinant human TREH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 203-552 aa of BC109206

  Sequence: YLTHTNDTAFLQENIETLALELDFWTKNRTVSVSLEGKNYLLNRYYVPYGGPRPESYSKDVELADTLPEGDREALWAELKAGAESGWDFSSRWLIGGPNPNSLSGIRTSKLVPVDLNAFLCQAEELMSNFYSRLGNDSQATKYRILRSQRLAALNTVLWDEQTGAWFDYDLEKKKKNREFYPSNLTPLWAGCFSDPGVADKALKYLEDNRILTYQYGIPTSLQKTGQQWDFPNAWAPLQDLVIRGLAKAPLRRAQEVAFQLAQNWIRTNFDVYSQKSAMYEKYDVSNGGQPGGGGEYEVQEGFGWTNGVVLMLLDRYGDRLTSGAKLAFLEPHCLAATLLPSLLLSLLPW

• Full Name: trehalase (brush-border membrane glycoprotein)
• Calculated Molecular Weight: 583 aa, 67 kDa
• Observed Molecular Weight: 67-70 kDa
• GenBank Accession Number: BC109206
• Gene Symbol: Trehalase
• Gene ID (NCBI): 11181
• RRID: AB_3742050
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O43280
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Trehalase is the enzyme hydrolyzing trehalose and belongs to the glycosyl hydrolase 37 family. In humans and most mammals, trehalase is found in the brush borders of the intestinal mucosa, kidney, liver, and blood plasma. Trehalases are conserved enzymes that catalyze the hydrolysis of one of two glycoside bonds of trehalose. With the exception of vertebrates where trehalase is required for the degradation of ingested trehalose, in other animal groups it is involved in diverse physiological processes including carbohydrate metabolism, resumption of growth in certain resting cells, germination of spores in fungi, recovery from stress conditions, etc (PMID: 25429048, PMID: 30628830).